Workflows

Sort by:
Showing 43 results. Use the filters on the left and the search box below to refine the results.
Wsdl: http://xml.nig.ac.jp/wsdl/Blast.wsdl
Original Uploader

Workflow Workflow for Protein Sequence Analysis (1)

Created: 09/01/08 @ 12:03:03 | Last updated: 09/01/08 @ 12:31:27

Credits: User M.B.Monteiro

Attributions: Workflow BLAST using DDBJ service Workflow Simplify a BLAST text file Workflow conditional branch

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Thumb
This workflow performs a generic protein sequence analysis. In order to do that a novel protein sequence enters into the software along with a list of known protein identifiers chosen by the biologist to perform a homology search, followed by a multiple sequence alignment and finally a phylogenetic analysis.

Rating: 4.0 / 5 (2 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 1795 times | Downloaded: 467 times

Tags (10):

Original Uploader

Workflow Gene annotation pipeline for the Graves di... (2)

Created: 03/10/07 @ 18:36:09 | Last updated: 22/11/07 @ 16:03:15

Credits: User Katy Wolstencroft User Peter Li

License: Creative Commons Attribution-No Derivative Works 3.0 Unported License

Thumb
This is a revised workflow for the Graves disease scenario gene annotation pipeline used in the myGrid project. The workflow had to be re-written due to the loss of the services invoked in the original workflow.

Rating: 0.0 / 5 (0 ratings) | Versions: 2 | Reviews: 0 | Comments: 1 | Citations: 0

Viewed: 664 times | Downloaded: 218 times

Tags (6):

Original Uploader

Workflow BLAST using DDBJ service (2)

Created: 03/10/07 @ 18:36:06 | Last updated: 03/12/09 @ 16:31:20

License: Creative Commons Attribution-No Derivative Works 3.0 Unported License

Thumb
Perform a sequence similarity search using the BLAST algorithm through the DDBJ web service.   Example input for this service are given below. query: >MySequence MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSS NSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSVFLASAEFCNIL SRVLARSRKRPAKIYVYINELCTVLKAHSIKKKLNLAPAASTTSEASGPNPPTEPPSDLT NTENTASEASRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSSYLQEAR LKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGLDTFPDY GDVLRAVEKAATRHSLGLP...

Rating: 4.5 / 5 (2 ratings) | Versions: 2 | Reviews: 0 | Comments: 1 | Citations: 0

Viewed: 640 times | Downloaded: 234 times

Tags (5):

Original Uploader

Workflow Multiple Blastp (2)

Created: 20/11/07 @ 16:58:38 | Last updated: 10/01/08 @ 12:09:38

Credits: User Kieren Lythgow

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Thumb
This is a workflow to automate multiple BLASTp jobs on a large list of protein sequences in FASTA format.

Rating: 5.0 / 5 (1 rating) | Versions: 2 | Reviews: 0 | Comments: 1 | Citations: 0

Viewed: 517 times | Downloaded: 165 times

Tags (4):

Original Uploader

Workflow BLASTP with simplified results returned (2)

Created: 03/10/07 @ 18:36:06 | Last updated: 03/12/09 @ 16:28:50

License: Creative Commons Attribution-No Derivative Works 3.0 Unported License

Thumb
Perform a blastp search on protein sequence and extract information based on the user input, e.g. a list of GI numbers. N.B. this workflow does not function correctly as it is designed for use with NCBI blast scripts. Some errors may occur. Please use two blast text file inputs for a secure result output.   Example input for this service are given below. query: >MySequence MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSS NSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSV...

Rating: 4.0 / 5 (1 rating) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 344 times | Downloaded: 115 times

Tags (6):

Original Uploader

Workflow BLASTP with simplified results returned (2)

Created: 03/10/07 @ 18:36:12 | Last updated: 06/03/08 @ 17:01:32

License: Creative Commons Attribution-No Derivative Works 3.0 Unported License

Thumb
This workflow Performs a blastp search on protein sequence, extracts sequence id within the blast report and retrives the corresponding seuqences.

Rating: 4.0 / 5 (2 ratings) | Versions: 2 | Reviews: 0 | Comments: 2 | Citations: 0

Viewed: 240 times | Downloaded: 64 times

Tags (3):

Original Uploader

Workflow Retrieve Protein Sequence (1)

Created: 30/07/08 @ 16:36:55 | Last updated: 03/12/09 @ 16:54:02

Credits: User Katy Wolstencroft

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Thumb
Retrieves a protein sequence in Fasta format from GenBank, given a GenBank identifier. Example input for this workflow is: EDL10223.1

Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 1 | Citations: 0

Viewed: 394 times | Downloaded: 131 times

Tags (5):

Original Uploader

Workflow ExampleWorkflow1 (2)

Created: 04/02/08 @ 14:19:24 | Last updated: 04/02/08 @ 15:52:46

Credits: User Katy Wolstencroft

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Thumb
This workflow was created based on the Leeds Taverna Workshop 2008-02-04 material developed by Katy.

Rating: 0.0 / 5 (0 ratings) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 137 times | Downloaded: 47 times

Tags (1):

Original Uploader

Workflow workflow1 (1)

Created: 16/11/09 @ 14:12:30

Credits: User Jorgep

Attributions: Workflow EBI_InterProScan for Taverna 2

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Thumb
blast dando o ID de uma proteinablast dando o ID de uma proteina ex: database is ‘SWISS’, for program, ‘blastp’, and for ID ‘1220173blast dando o ID de uma proteina with interpro scan ex: database is SWISS’, for program, blastp, and for ID 1220173blast dando o ID de uma proteina ex: database is SWISS’, for program, blastp, and for ID 1220173

Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 47 times | Downloaded: 15 times

Tags (2):

Original Uploader

Workflow Example 3 (1)

Created: 20/10/09 @ 17:00:59

Credits: User Ruben

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Thumb
Search in the Datenbank SWISS the Sequence 1220173

Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 82 times | Downloaded: 30 times

Tags (5):

Sort by:

Results per page:

New/Upload

Log in / Register

Username or Email:

Password:

Remember me:

OR

Use OpenID:


(eg: name.myopenid.com)

Need an account?
Click here to register

Forgot Password?

Front Page

Home

Invite people to myExperiment Alpha

Help pages

About Us

News and Events

Mailing List

Contact Us

Developers

Publications


Taverna Workflow Workbench

myGrid

BioCatalogue

Trident

Google Coop Search

EPSRC

JISC

Microsoft

Powered by:

Rails

Icons:
Silk icon set 1.3